New release (2023.1) online!
Learn more about features, functions and data:
BKMS-react is an integrated and non-redundant biochemical reaction database containing known enzyme-catalyzed and spontaneous reactions. Biochemical reactions collected from BRENDA, KEGG, MetaCyc and SABIO-RK were matched and integrated by aligning substrates and products.
 

:= BRENDA, := KEGG, := MetaCyc, := SABIO-RK
:= amino acid sequences := show the reaction diagram
Results per page 
  • 10 results
  • 50 results
  • 100 results
  • 500 results
  • 100000 results
Show or hide columns 
  • EC Number
  • Reaction
  • Pathways
  • Reaction IDs
  • Stoichiometry Check
  • Missing Substrate
  • Missing Product
  • Commentary
  • Remark
EC Number
Reaction
Pathways
Reaction IDs
Stoichiometry Check  
Commentary
Rhizopuspepsin
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O = L-Phe + VNQH + LCGSH + L-Leu + L-Val + L-Glu + L-Ala + L-Leu + L-Tyr + LVCG + ERG + L-Phe + L-Phe + YTPKA
-
incomplete
-